![]() |
silent |
silent finds positions in a sequence where a point mutation could be made to introduce a specified restriction enzyme recognition site without changing the translation.
Several restriction enzyme can be specified.
% silent Silent mutation restriction enzyme scan Input sequence: tembl:hsfau Comma separated enzyme list [all]: ecori,hindiii Output file [hsfau.silent]: |
Go to the input files for this example
Go to the output files for this example
Mandatory qualifiers: [-seq] sequence Sequence USA -enzymes string Comma separated enzyme list [-outf] outfile Output file name Optional qualifiers: (none) Advanced qualifiers: -sshow boolean Display untranslated sequence -tshow boolean Display translated sequence -allmut boolean Display all mutations General qualifiers: -help boolean Report command line options. More information on associated and general qualifiers can be found with -help -verbose |
Mandatory qualifiers | Allowed values | Default | |
---|---|---|---|
[-seq] (Parameter 1) |
Sequence USA | Readable sequence | Required |
-enzymes | Comma separated enzyme list | Any string is accepted | all |
[-outf] (Parameter 2) |
Output file name | Output file | <sequence>.silent |
Optional qualifiers | Allowed values | Default | |
(none) | |||
Advanced qualifiers | Allowed values | Default | |
-sshow | Display untranslated sequence | Boolean value Yes/No | No |
-tshow | Display translated sequence | Boolean value Yes/No | No |
-allmut | Display all mutations | Boolean value Yes/No | No |
ID HSFAU standard; RNA; HUM; 518 BP. XX AC X65923; XX SV X65923.1 XX DT 13-MAY-1992 (Rel. 31, Created) DT 23-SEP-1993 (Rel. 37, Last updated, Version 10) XX DE H.sapiens fau mRNA XX KW fau gene. XX OS Homo sapiens (human) OC Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; OC Eutheria; Primates; Catarrhini; Hominidae; Homo. XX RN [1] RP 1-518 RA Michiels L.M.R.; RT ; RL Submitted (29-APR-1992) to the EMBL/GenBank/DDBJ databases. RL L.M.R. Michiels, University of Antwerp, Dept of Biochemistry, RL Universiteisplein 1, 2610 Wilrijk, BELGIUM XX RN [2] RP 1-518 RX MEDLINE; 93368957. RA Michiels L., Van der Rauwelaert E., Van Hasselt F., Kas K., Merregaert J.; RT " fau cDNA encodes a ubiquitin-like-S30 fusion protein and is expressed as RT an antisense sequences in the Finkel-Biskis-Reilly murine sarcoma virus"; RL Oncogene 8:2537-2546(1993). XX DR SWISS-PROT; P35544; UBIM_HUMAN. DR SWISS-PROT; Q05472; RS30_HUMAN. XX FH Key Location/Qualifiers FH FT source 1..518 FT /chromosome="11q" FT /db_xref="taxon:9606" FT /organism="Homo sapiens" FT /tissue_type="placenta" FT /clone_lib="cDNA" FT /clone="pUIA 631" FT /map="13" FT misc_feature 57..278 FT /note="ubiquitin like part" FT CDS 57..458 FT /db_xref="SWISS-PROT:P35544" FT /db_xref="SWISS-PROT:Q05472" FT /gene="fau" FT /protein_id="CAA46716.1" FT /translation="MQLFVRAQELHTFEVTGQETVAQIKAHVASLEGIAPEDQVVLLAG FT APLEDEATLGQCGVEALTTLEVAGRMLGGKVHGSLARAGKVRGQTPKVAKQEKKKKKTG FT RAKRRMQYNRRFVNVVPTFGKKKGPNANS" FT misc_feature 98..102 FT /note="nucleolar localization signal" FT misc_feature 279..458 FT /note="S30 part" FT polyA_signal 484..489 FT polyA_site 509 XX SQ Sequence 518 BP; 125 A; 139 C; 148 G; 106 T; 0 other; ttcctctttc tcgactccat cttcgcggta gctgggaccg ccgttcagtc gccaatatgc 60 agctctttgt ccgcgcccag gagctacaca ccttcgaggt gaccggccag gaaacggtcg 120 cccagatcaa ggctcatgta gcctcactgg agggcattgc cccggaagat caagtcgtgc 180 tcctggcagg cgcgcccctg gaggatgagg ccactctggg ccagtgcggg gtggaggccc 240 tgactaccct ggaagtagca ggccgcatgc ttggaggtaa agttcatggt tccctggccc 300 gtgctggaaa agtgagaggt cagactccta aggtggccaa acaggagaag aagaagaaga 360 agacaggtcg ggctaagcgg cggatgcagt acaaccggcg ctttgtcaac gttgtgccca 420 cctttggcaa gaagaagggc cccaatgcca actcttaagt cttttgtaat tctggctttc 480 tctaataaaa aagccactta gttcagtcaa aaaaaaaa 518 // |
Results for HSFAU: KEY: Enzyme Enzyme name RS-Pattern Restriction enzyme recognition site pattern Match-Posn Position of the first base of RS pattern in sequence AA Amino acid. Original sequence(.)After mutation Base-Posn Position of base to be mutated in sequence Mutation The base mutation to perform Silent mutations Enzyme RS-Pattern Match-Posn AA Base-Posn Mutation Results for reverse of HSFAU: Silent mutations Enzyme RS-Pattern Match-Posn AA Base-Posn Mutation HindIII AAGCTT 267 A.A 268 A->T |
Program name | Description |
---|---|
recoder | Remove restriction sites but maintain the same translation |
redata | Search REBASE for enzyme name, references, suppliers etc |
remap | Display a sequence with restriction cut sites, translation etc |
restover | Finds restriction enzymes that produce a specific overhang |
restrict | Finds restriction enzyme cleavage sites |
showseq | Display a sequence with features, translation etc |
silent does the opposite to recode. silent finds sites where a restriction enzyme site can be introduced without changing the translation in frame 1 of the sequence. recode finds sites where a restriction enzyme site can be removed without changing the translation in frame 1 of the sequence.